General Information

  • ID:  hor000105
  • Uniprot ID:  P35454??20-28)
  • Protein name:  Oxytocin
  • Gene name:  Oxt
  • Organism:  Mus musculus (Mouse)
  • Family:  Vasopressin/oxytocin family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Mus (subgenus), Mus (genus), Murinae (subfamily), Muridae (family), Muroidea, Myomorpha (suborder), Rodentia (order), Glires, Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0005184 neuropeptide hormone activity; GO:0005185 neurohypophyseal hormone activity; GO:0031855 oxytocin receptor binding; GO:0031894 V1A vasopressin receptor binding
  • GO BP:  GO:0001975 response to amphetamine; GO:0002027 regulation of heart rate; GO:0002125 maternal aggressive behavior; GO:0007165 signal transduction; GO:0007204 positive regulation of cytosolic calcium ion concentration; GO:0007507 heart development; GO:0007565 female pregnancy; GO:0007613 memory; GO:0007625 grooming behavior
  • GO CC:  NA

Sequence Information

  • Sequence:  CYIQNCPLG
  • Length:  9(20-28)
  • Propeptide:  MACPSLACCLLGLLALTSACYIQNCPLGGKRAVLDLDMRKCLPCGPGGKGRCFGPSICCADELGCFVGTAEALRCQEENYLPSPCQSGQKPCGSGGRCAATGICCSPDGCRTDPACDPESAFSER
  • Signal peptide:  MACPSLACCLLGLLALTSA
  • Modification:  T9 Glycine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Cause contraction of the smooth muscle of the uterus and of the mammary gland;modulates social interaction
  • Mechanism:  NA
  • Cross BBB:  NO
  • Target:  Oxtr
  • Target Unid:  P97926
  • IC50: Prostaglandin F metabolite(PGFM) release on administeration of 10 iu of oxytocin= 18.48???.62 pg/ml ( PubMed ID: 10454085 )
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: 6.78 minutes; /406.8 seconds ( PubMed ID: 10454085 )

Structure

  • Disulfide bond:  45663
  • Structure ID:  AF-P35454-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor000105_AF2.pdbhor000105_ESM.pdb

    Please select some value
    Remove Label
    Add Label

    Please select some value
    Remove Label
    Add Label

Physical Information

Mass: 115308 Formula: C43H67N11O13S2
Absent amino acids: ADEFHKMRSTVW Common amino acids: C
pI: 5.81 Basic residues: 0
Polar residues: 5 Hydrophobic residues: 2
Hydrophobicity: 33.33 Boman Index: 102
Half-Life: 1.2 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 86.67
Instability Index: 2708.89 Extinction Coefficient cystines: 1615
Absorbance 280nm: 201.88

Literature

  • PubMed ID:  27558735##10454085
  • Title:  The Impact of Oxytocin Gene Knockout on Sexual Behavior and Gene Expression Related to Neuroendocrine Systems in the Brain of Female Mice